| Class b: All beta proteins [48724] (144 folds) |
| Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) ![]() the N-terminal domains of these repressors bind DNA |
| Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein) |
| Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) |
| Species Escherichia coli [TaxId:562] [50040] (3 PDB entries) |
| Domain d1bia_2: 1bia 271-317 [24447] Other proteins in same PDB: d1bia_1, d1bia_3 |
PDB Entry: 1bia (more details), 2.3 Å
SCOP Domain Sequences for d1bia_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bia_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr
Timeline for d1bia_2: