Lineage for d1bia_2 (1bia 271-317)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372426Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 372427Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein)
  6. 372428Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)
  7. 372429Species Escherichia coli [TaxId:562] [50040] (3 PDB entries)
  8. 372430Domain d1bia_2: 1bia 271-317 [24447]
    Other proteins in same PDB: d1bia_1, d1bia_3

Details for d1bia_2

PDB Entry: 1bia (more details), 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bia_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bia_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

SCOP Domain Coordinates for d1bia_2:

Click to download the PDB-style file with coordinates for d1bia_2.
(The format of our PDB-style files is described here.)

Timeline for d1bia_2: