SCOPe 2.05: Domain d2x7wa_: 2x7w A:

Lineage for d2x7wa_ (2x7w A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.0: automated matches [191634] (1 protein)
   not a true family

6. Protein automated matches [191168] (3 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [255680] (3 PDB entries)

8. Domain d2x7wa_: 2x7w A: [244452]
   automated match to d3aama_
   complexed with bcn, cd, zn

Details for d2x7wa_

PDB Entry: 2x7w, 2.36 Å

PDB Description: Crystal structure of Thermotoga maritima endonuclease IV in the presence of cadmium and zinc

PDB Compounds: (A:) Probable endonuclease 4

SCOPe Domain Sequences for d2x7wa_:

Sequence; same for both SEQRES and ATOM records:

>d2x7wa_ c.1.15.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mikigahmpiskgfdrvpqdtvniggnsfqifphnarswsaklpsdeaatkfkremkkhg
idwenafchsgylinlaspkddiwqksvellkkeveicrklgirylnihpgshlgtgeee
gidrivrglnevlnntegvvillenvsqkggnigykleqlkkirdlvdqrdrvaitydtc
hgfdsgyditkkegveallneieslfglerlkmihlndskyplgaakdrherigsgfige
egfavffsfkeiqevpwiletpggneehaedikkvfeiiekfgiev

Timeline for d2x7wa_:

• d2x7wa_ first appeared in SCOPe 2.04
  
• d2x7wa_ appears in SCOPe 2.06
  
• d2x7wa_ appears in the current release, SCOPe 2.08