Lineage for d2x6aa1 (2x6a A:12-138)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252772Protein automated matches [190184] (3 species)
    not a true protein
  7. 2252775Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries)
  8. 2252778Domain d2x6aa1: 2x6a A:12-138 [244439]
    Other proteins in same PDB: d2x6aa2, d2x6aa3
    automated match to d2wlka1
    complexed with k, pc

Details for d2x6aa1

PDB Entry: 2x6a (more details), 3.1 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum
PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2x6aa1:

Sequence, based on SEQRES records: (download)

>d2x6aa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac
gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasli
yarftrp

Sequence, based on observed residues (ATOM records): (download)

>d2x6aa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglddhyhdlltvswpvfitlitglylvtnalfalaylacgdvien
arpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftr
p

SCOPe Domain Coordinates for d2x6aa1:

Click to download the PDB-style file with coordinates for d2x6aa1.
(The format of our PDB-style files is described here.)

Timeline for d2x6aa1: