SCOPe 2.04: Domain d2x6aa1: 2x6a A:12-138

Lineage for d2x6aa1 (2x6a A:12-138)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries)

8. Domain d2x6aa1: 2x6a A:12-138 [244439]
   Other proteins in same PDB: d2x6aa2
   automated match to d2wlka1
   complexed with k, pc

Details for d2x6aa1

PDB Entry: 2x6a, 3.1 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2x6aa1:

Sequence, based on SEQRES records:

>d2x6aa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac
gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasli
yarftrp

Sequence, based on observed residues (ATOM records):

>d2x6aa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglddhyhdlltvswpvfitlitglylvtnalfalaylacgdvien
arpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftr
p

Timeline for d2x6aa1:

• d2x6aa1 is new in SCOPe 2.04-stable
  
• d2x6aa1 appears in SCOPe 2.05
  
• d2x6aa1 appears in the current release, SCOPe 2.08