Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein automated matches [190184] (3 species) not a true protein |
Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries) |
Domain d2x6aa1: 2x6a A:12-138 [244439] Other proteins in same PDB: d2x6aa2 automated match to d2wlka1 complexed with k, pc |
PDB Entry: 2x6a (more details), 3.1 Å
SCOPe Domain Sequences for d2x6aa1:
Sequence, based on SEQRES records: (download)
>d2x6aa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasli yarftrp
>d2x6aa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} prilnsdgssnitrlglddhyhdlltvswpvfitlitglylvtnalfalaylacgdvien arpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftr p
Timeline for d2x6aa1: