Lineage for d2x5vc_ (2x5v C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506148Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1506149Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1506254Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 1506255Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 1506256Species Rhodopseudomonas viridis [TaxId:1079] [48709] (18 PDB entries)
  8. 1506274Domain d2x5vc_: 2x5v C: [244433]
    Other proteins in same PDB: d2x5vh1, d2x5vh2, d2x5vl_, d2x5vm_
    automated match to d3t6ec_
    complexed with bcb, bpb, fe2, hem, mq7

Details for d2x5vc_

PDB Entry: 2x5v (more details), 3 Å

PDB Description: 80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre 3 millisecond following photoactivation.
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2x5vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x5vc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d2x5vc_:

Click to download the PDB-style file with coordinates for d2x5vc_.
(The format of our PDB-style files is described here.)

Timeline for d2x5vc_: