![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
![]() | Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species) |
![]() | Species Rhodopseudomonas viridis [TaxId:1079] [48709] (18 PDB entries) |
![]() | Domain d2x5uc_: 2x5u C: [244428] Other proteins in same PDB: d2x5uh1, d2x5uh2, d2x5ul_, d2x5um_ automated match to d3t6ec_ complexed with bcb, bpb, fe2, hem, mq7 |
PDB Entry: 2x5u (more details), 3 Å
SCOPe Domain Sequences for d2x5uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x5uc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]} cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea pqadcrtchqgvtkplfgasrlkdypelgpik
Timeline for d2x5uc_:
![]() Domains from other chains: (mouse over for more information) d2x5uh1, d2x5uh2, d2x5ul_, d2x5um_ |