SCOPe 2.08: Domain d2x5uc_: 2x5u C:

Lineage for d2x5uc_ (2x5u C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (28 PDB entries)

8. Domain d2x5uc_: 2x5u C: [244428]
   Other proteins in same PDB: d2x5uh1, d2x5uh2, d2x5ul_, d2x5um_
   automated match to d3t6ec_
   complexed with bcb, bpb, fe2, hec, mq7

Details for d2x5uc_

PDB Entry: 2x5u, 3 Å

PDB Description: 80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre without illumination.

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2x5uc_:

Sequence; same for both SEQRES and ATOM records:

>d2x5uc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d2x5uc_:

• d2x5uc_ first appeared in SCOPe 2.04
  
• d2x5uc_ appears in SCOPe 2.07