Lineage for d2x5oa1 (2x5o A:1-93)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833628Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 1833629Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 1833651Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 1833652Protein automated matches [254548] (3 species)
    not a true protein
  7. 1833662Species Escherichia coli [TaxId:668369] [255649] (2 PDB entries)
  8. 1833663Domain d2x5oa1: 2x5o A:1-93 [244425]
    Other proteins in same PDB: d2x5oa2, d2x5oa3
    automated match to d4uaga1
    complexed with azi, cl, so3, so4, vsv

Details for d2x5oa1

PDB Entry: 2x5o (more details), 1.46 Å

PDB Description: discovery of novel 5-benzylidenerhodanine- and 5-benzylidene- thiazolidine-2,4-dione inhibitors of murd ligase
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2x5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x5oa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 668369]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d2x5oa1:

Click to download the PDB-style file with coordinates for d2x5oa1.
(The format of our PDB-style files is described here.)

Timeline for d2x5oa1: