Lineage for d2x5la_ (2x5l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005739Species Mycobacterium tuberculosis [TaxId:83332] [226004] (12 PDB entries)
  8. 2005741Domain d2x5la_: 2x5l A: [244424]
    automated match to d2xc3a_
    complexed with hem

Details for d2x5la_

PDB Entry: 2x5l (more details), 1.48 Å

PDB Description: x-ray structure of the substrate-free mycobacterium tuberculosis cytochrome p450 cyp125, alternative crystal form
PDB Compounds: (A:) putative cytochrome p450 125

SCOPe Domain Sequences for d2x5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x5la_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pnlppgfdftdpaiyaerlpvaefaelrsaapiwwngqdpgkgggfhdggfwaitklndv
keisrhsdvfssyengviprfkndiaredievqrfvmlnmdaphhtrlrkiisrgftpra
vgrlhdelqeraqkiaaeaaaagsgdfveqvscelplqaiagllgvpqedrgklfhwsne
mtgnedpeyahidpkassaeligyamkmaeekaknpaddivtqliqadidgeklsddefg
ffvvmlavagnettrnsitqgmmafaehpdqwelykkvrpetaadeivrwatpvtafqrt
alrdyelsgvqikkgqrvvmfyrsanfdeevfqdpftfnilrnpnphvgfggtgahycig
anlarmtinlifnavadhmpdlkpisaperlrsgwlngikhwqvdytgrlpvah

SCOPe Domain Coordinates for d2x5la_:

Click to download the PDB-style file with coordinates for d2x5la_.
(The format of our PDB-style files is described here.)

Timeline for d2x5la_: