SCOPe 2.06: Domain d2x5ia_: 2x5i A:

Lineage for d2x5ia_ (2x5i A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (15 species)
   not a true protein

7. Species Human echovirus 7 [TaxId:46018] [255678] (1 PDB entry)

8. Domain d2x5ia_: 2x5i A: [244422]
   automated match to d1cov1_
   complexed with dao

Details for d2x5ia_

PDB Entry: 2x5i, 3.1 Å

PDB Description: crystal structure echovirus 7

PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d2x5ia_:

Sequence; same for both SEQRES and ATOM records:

>d2x5ia_ b.121.4.1 (A:) automated matches {Human echovirus 7 [TaxId: 46018]}
iarvadtvasgpsnstsipaltavetghtsqvepsdtmqtrhvknyhsrsestvenflsr
sacvyieeyytkdqdnvnrymswtinarrmvqlrrkfelftymrfdmeitfvitsrqlpg
tsiaqdmpplthqimyippggpvpnsvtdfawqtstnpsifwtegnapprmsipfisign
aysnfydgwshfsqngvygynalnnmgklyarhvnkdtpyqmsstirvyfkpkhirvwvp
rpprlspyikssnvnfnptnltderssityvpdtirp

Timeline for d2x5ia_:

• d2x5ia_ first appeared in SCOPe 2.04
  
• d2x5ia_ appears in SCOPe 2.05
  
• d2x5ia_ appears in SCOPe 2.07
  
• d2x5ia_ appears in the current release, SCOPe 2.08