Lineage for d2x42a3 (2x42 A:600-721)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2040231Superfamily b.1.31: Fibronectin III-like [254143] (2 families) (S)
    Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2)
  5. 2040232Family b.1.31.1: Fibronectin III-like [254189] (1 protein)
  6. 2040233Protein Beta-glucosidase C-terminal domain [254418] (2 species)
  7. 2040243Species Thermotoga neapolitana [TaxId:309803] [254859] (2 PDB entries)
  8. 2040244Domain d2x42a3: 2x42 A:600-721 [244412]
    Other proteins in same PDB: d2x42a1, d2x42a2
    complexed with br, glc

Details for d2x42a3

PDB Entry: 2x42 (more details), 2.1 Å

PDB Description: structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2x42a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x42a3 b.1.31.1 (A:600-721) Beta-glucosidase C-terminal domain {Thermotoga neapolitana [TaxId: 309803]}
yttfeysdlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhkt
rllnpgeseevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrf
kp

SCOPe Domain Coordinates for d2x42a3:

Click to download the PDB-style file with coordinates for d2x42a3.
(The format of our PDB-style files is described here.)

Timeline for d2x42a3: