![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.31: Fibronectin III-like [254143] (2 families) ![]() Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2) |
![]() | Family b.1.31.1: Fibronectin III-like [254189] (1 protein) |
![]() | Protein Beta-glucosidase C-terminal domain [254418] (2 species) |
![]() | Species Thermotoga neapolitana [TaxId:309803] [254859] (2 PDB entries) |
![]() | Domain d2x42a3: 2x42 A:600-721 [244412] Other proteins in same PDB: d2x42a1, d2x42a2 complexed with br, glc |
PDB Entry: 2x42 (more details), 2.1 Å
SCOPe Domain Sequences for d2x42a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x42a3 b.1.31.1 (A:600-721) Beta-glucosidase C-terminal domain {Thermotoga neapolitana [TaxId: 309803]} yttfeysdlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhkt rllnpgeseevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrf kp
Timeline for d2x42a3: