Lineage for d2x42a1 (2x42 A:2-319)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832028Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2832048Protein Beta-glucosidase [254415] (2 species)
    second beta strand is antiparallel to the rest
  7. 2832058Species Thermotoga neapolitana [TaxId:309803] [254854] (2 PDB entries)
  8. 2832060Domain d2x42a1: 2x42 A:2-319 [244410]
    Other proteins in same PDB: d2x42a2, d2x42a3
    complexed with br, glc

Details for d2x42a1

PDB Entry: 2x42 (more details), 2.1 Å

PDB Description: structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2x42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x42a1 c.1.8.7 (A:2-319) Beta-glucosidase {Thermotoga neapolitana [TaxId: 309803]}
ekvneilsqltleekvklvvgvglpglfgnphsrvagaagethpvprvglpafvladgpa
glrinptrendentyyttafpveimlastwnrelleevgkamgeevreygvdvllapamn
ihrnplcgrnfeyysedpvlsgemassfvkgvqsqgvgacikhfvannqetnrmvvdtiv
seralreiylrgfeiavkkskpwsvmsaynklngkycsqnewllkkvlreewgfegfvms
awyagdnpveqlkagndlimpgkayqvnterrdeieeimealkegklseevldecvrnil
kvlvnapsfknyrysnkp

SCOPe Domain Coordinates for d2x42a1:

Click to download the PDB-style file with coordinates for d2x42a1.
(The format of our PDB-style files is described here.)

Timeline for d2x42a1: