![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins) |
![]() | Protein Rieske-type ferredoxin associated with biphenyl dioxygenase [50031] (1 species) |
![]() | Species Burkholderia cepacia [TaxId:292] [50032] (1 PDB entry) |
![]() | Domain d1fqta_: 1fqt A: [24441] |
PDB Entry: 1fqt (more details), 1.6 Å
SCOP Domain Sequences for d1fqta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia} mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap
Timeline for d1fqta_: