SCOPe 2.05: Domain d2x40a3: 2x40 A:600-721

Lineage for d2x40a3 (2x40 A:600-721)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.31: Fibronectin III-like [254143] (2 families)
   Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2)

5. Family b.1.31.0: automated matches [254280] (1 protein)
   not a true family

6. Protein automated matches [254649] (1 species)
   not a true protein

7. Species Thermotoga neapolitana [TaxId:309803] [255676] (2 PDB entries)

8. Domain d2x40a3: 2x40 A:600-721 [244406]
   Other proteins in same PDB: d2x40a1, d2x40a2
   automated match to d2x42a3
   complexed with br, gol

Details for d2x40a3

PDB Entry: 2x40, 2.31 Å

PDB Description: structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glycerol

PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2x40a3:

Sequence; same for both SEQRES and ATOM records:

>d2x40a3 b.1.31.0 (A:600-721) automated matches {Thermotoga neapolitana [TaxId: 309803]}
yttfeysdlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhkt
rllnpgeseevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrf
kp

Timeline for d2x40a3:

• d2x40a3 first appeared in SCOPe 2.04
  
• d2x40a3 appears in SCOPe 2.06
  
• d2x40a3 appears in the current release, SCOPe 2.08