Lineage for d2x40a2 (2x40 A:320-599)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103295Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2103296Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 protein domains)
  6. 2103329Protein automated matches [254648] (1 species)
    not a true protein
  7. 2103330Species Thermotoga neapolitana [TaxId:309803] [255675] (4 PDB entries)
  8. 2103333Domain d2x40a2: 2x40 A:320-599 [244405]
    Other proteins in same PDB: d2x40a1, d2x40a3
    automated match to d2x42a2
    complexed with br, gol

Details for d2x40a2

PDB Entry: 2x40 (more details), 2.31 Å

PDB Description: structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glycerol
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2x40a2:

Sequence, based on SEQRES records: (download)

>d2x40a2 c.23.11.1 (A:320-599) automated matches {Thermotoga neapolitana [TaxId: 309803]}
dlekhakvayeagaegvvllrneealplsenskialfgtgqietikggtgsgdthpryai
silegikerglnfdeelaktyedyikkmreteeykprrdswgtiikpklpenflsekeih
klakkndvavivisrisgegydrkpvkgdfylsddetdliktvsrefheqgkkvivllni
gspvevvswrdlvdgillvwqagqetgrivadvltgrinpsgklpttfprdysdvpswtf
pgepkdnpqkvvyeediyvgyryydtfgvepayefgygls

Sequence, based on observed residues (ATOM records): (download)

>d2x40a2 c.23.11.1 (A:320-599) automated matches {Thermotoga neapolitana [TaxId: 309803]}
dlekhakvayeagaegvvllrneealplsenskialfgtgqietikggtgsgdthpryai
silegikerglnfdeelaktyedyikkmreteeykprikpklpenflsekeihklakknd
vavivisrisgegydrkpvkgdfylsddetdliktvsrefheqgkkvivllnigspvevv
swrdlvdgillvwqagqetgrivadvltgrinpsgklpttfprdysdvpswtfpgepkdn
pqkvvyeediyvgyryydtfgvepayefgygls

SCOPe Domain Coordinates for d2x40a2:

Click to download the PDB-style file with coordinates for d2x40a2.
(The format of our PDB-style files is described here.)

Timeline for d2x40a2: