SCOPe 2.05: Domain d2x40a1: 2x40 A:2-319

Lineage for d2x40a1 (2x40 A:2-319)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.7: NagZ-like [51553] (4 proteins)
   Pfam PF00933; Glycosyl hydrolase family 3 domain
   Some members have reversed beta strand compared to other members of fold

6. Protein automated matches [191056] (3 species)
   not a true protein

7. Species Thermotoga neapolitana [TaxId:309803] [255674] (2 PDB entries)

8. Domain d2x40a1: 2x40 A:2-319 [244404]
   Other proteins in same PDB: d2x40a2, d2x40a3
   automated match to d2x42a1
   complexed with br, gol

Details for d2x40a1

PDB Entry: 2x40, 2.31 Å

PDB Description: structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glycerol

PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2x40a1:

Sequence; same for both SEQRES and ATOM records:

>d2x40a1 c.1.8.7 (A:2-319) automated matches {Thermotoga neapolitana [TaxId: 309803]}
ekvneilsqltleekvklvvgvglpglfgnphsrvagaagethpvprvglpafvladgpa
glrinptrendentyyttafpveimlastwnrelleevgkamgeevreygvdvllapamn
ihrnplcgrnfeyysedpvlsgemassfvkgvqsqgvgacikhfvannqetnrmvvdtiv
seralreiylrgfeiavkkskpwsvmsaynklngkycsqnewllkkvlreewgfegfvms
dwyagdnpveqlkagndlimpgkayqvnterrdeieeimealkegklseevldecvrnil
kvlvnapsfknyrysnkp

Timeline for d2x40a1:

• d2x40a1 first appeared in SCOPe 2.04
  
• d2x40a1 appears in SCOPe 2.06
  
• d2x40a1 appears in the current release, SCOPe 2.08