SCOPe 2.06: Domain d1g8jd_: 1g8j D:

Lineage for d1g8jd_ (1g8j D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein Arsenite oxidase Rieske subunit [50029] (1 species)

7. Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)

8. Domain d1g8jd_: 1g8j D: [24440]
   Other proteins in same PDB: d1g8ja1, d1g8ja2, d1g8jc1, d1g8jc2
   complexed with 4mo, f3s, fes, mgd, o

Details for d1g8jd_

PDB Entry: 1g8j, 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

PDB Compounds: (D:) arsenite oxidase

SCOPe Domain Sequences for d1g8jd_:

Sequence; same for both SEQRES and ATOM records:

>d1g8jd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]}
aypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmg
cptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgl
iygrqanvi

Timeline for d1g8jd_:

• d1g8jd_ first appeared (with stable ids) in SCOP 1.55
  
• d1g8jd_ appears in SCOPe 2.05
  
• d1g8jd_ appears in SCOPe 2.07
  
• d1g8jd_ appears in the current release, SCOPe 2.08