Lineage for d1g8jd_ (1g8j D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109277Fold b.33: ISP domain [50021] (1 superfamily)
  4. 109278Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 109279Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
  6. 109280Protein Arsenite oxidase Rieske subunit [50029] (1 species)
  7. 109281Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)
  8. 109287Domain d1g8jd_: 1g8j D: [24440]
    Other proteins in same PDB: d1g8ja1, d1g8ja2, d1g8jc1, d1g8jc2

Details for d1g8jd_

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8jd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis}
aypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmg
cptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgl
iygrqanvi

SCOP Domain Coordinates for d1g8jd_:

Click to download the PDB-style file with coordinates for d1g8jd_.
(The format of our PDB-style files is described here.)

Timeline for d1g8jd_: