Lineage for d2x177_ (2x17 7:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704750Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries)
  8. 2704866Domain d2x177_: 2x17 7: [244386]
    automated match to d2jd60_
    complexed with ag

Details for d2x177_

PDB Entry: 2x17 (more details), 3.1 Å

PDB Description: the x-ray structure of ferritin from pyrococcus furiosus loaded with ag(i)
PDB Compounds: (7:) putative ferritin homolog

SCOPe Domain Sequences for d2x177_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x177_ a.25.1.0 (7:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg

SCOPe Domain Coordinates for d2x177_:

Click to download the PDB-style file with coordinates for d2x177_.
(The format of our PDB-style files is described here.)

Timeline for d2x177_: