![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries) |
![]() | Domain d2x177_: 2x17 7: [244386] automated match to d2jd60_ complexed with ag |
PDB Entry: 2x17 (more details), 3.1 Å
SCOPe Domain Sequences for d2x177_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x177_ a.25.1.0 (7:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
Timeline for d2x177_: