![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein Arsenite oxidase Rieske subunit [50029] (1 species) |
![]() | Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries) |
![]() | Domain d1g8kh_: 1g8k H: [24438] Other proteins in same PDB: d1g8ka1, d1g8ka2, d1g8kc1, d1g8kc2, d1g8ke1, d1g8ke2, d1g8kg1, d1g8kg2 complexed with 4mo, ca, edo, f3s, fes, hg, mgd, o |
PDB Entry: 1g8k (more details), 1.64 Å
SCOPe Domain Sequences for d1g8kh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8kh_ b.33.1.1 (H:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg vdgliygrqanvi
Timeline for d1g8kh_: