Lineage for d2wzye1 (2wzy E:1-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (4 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (52 PDB entries)
  8. 2408646Domain d2wzye1: 2wzy E:1-208 [244368]
    Other proteins in same PDB: d2wzya2, d2wzyb2, d2wzyc2, d2wzyd2, d2wzye2, d2wzyf2, d2wzyg2, d2wzyh2, d2wzyi2, d2wzyj2
    automated match to d2c9ta_
    complexed with sqx

Details for d2wzye1

PDB Entry: 2wzy (more details), 2.51 Å

PDB Description: crystal structure of a-achbp in complex with 13-desmethyl spirolide c
PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wzye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wzye1 b.96.1.0 (E:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d2wzye1:

Click to download the PDB-style file with coordinates for d2wzye1.
(The format of our PDB-style files is described here.)

Timeline for d2wzye1: