SCOPe 2.06: Domain d2wzya1: 2wzy A:1-208

Lineage for d2wzya1 (2wzy A:1-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d2wzya1: 2wzy A:1-208 [244364]
   Other proteins in same PDB: d2wzya2, d2wzyb2, d2wzyc2, d2wzyd2, d2wzye2, d2wzyf2, d2wzyg2, d2wzyh2, d2wzyi2, d2wzyj2
   automated match to d2c9ta_
   complexed with sqx

Details for d2wzya1

PDB Entry: 2wzy, 2.51 Å

PDB Description: crystal structure of a-achbp in complex with 13-desmethyl spirolide c

PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wzya1:

Sequence; same for both SEQRES and ATOM records:

>d2wzya1 b.96.1.0 (A:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d2wzya1:

• d2wzya1 first appeared in SCOPe 2.04, called d2wzya_
  
• d2wzya1 was called d2wzya_ in SCOPe 2.05
  
• d2wzya1 appears in SCOPe 2.07
  
• d2wzya1 appears in the current release, SCOPe 2.08