SCOPe 2.05: Domain d2wzr3_: 2wzr 3:

Lineage for d2wzr3_ (2wzr 3:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (11 species)
   not a true protein

7. Species Foot-and-mouth disease virus [TaxId:12122] [255673] (1 PDB entry)

8. Domain d2wzr3_: 2wzr 3: [244363]
   Other proteins in same PDB: d2wzr1_
   automated match to d1fmd3_

Details for d2wzr3_

PDB Entry: 2wzr, 3 Å

PDB Description: the structure of foot and mouth disease virus serotype sat1

PDB Compounds: (3:) Polyprotein

SCOPe Domain Sequences for d2wzr3_:

Sequence; same for both SEQRES and ATOM records:

>d2wzr3_ b.121.4.1 (3:) automated matches {Foot-and-mouth disease virus [TaxId: 12122]}
gilpvavsdgyggfqntdpktsdpvyghvynpartlypgrftnlldvaeacptlldfngv
pyvqtqsnsgskvlacfdlafghknmkntymsglaqyfaqysgtlnlhfmytgptnnkak
ymvayippgthplpetpemashcyhaewdtglnstftftvpyfsaadyaytyadepeqas
vqgwvgvyqitdthekdgavivtvsagpdfefrmpispsrq

Timeline for d2wzr3_:

• d2wzr3_ first appeared in SCOPe 2.04
  
• d2wzr3_ appears in SCOPe 2.06
  
• d2wzr3_ appears in the current release, SCOPe 2.08