Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Foot-and-mouth disease virus [TaxId:12122] [255672] (1 PDB entry) |
Domain d2wzr1_: 2wzr 1: [244362] Other proteins in same PDB: d2wzr3_ automated match to d1fmd1_ |
PDB Entry: 2wzr (more details), 3 Å
SCOPe Domain Sequences for d2wzr1_:
Sequence, based on SEQRES records: (download)
>d2wzr1_ b.121.4.0 (1:) automated matches {Foot-and-mouth disease virus [TaxId: 12122]} ttsagegadpvttdasahggdtrttrrahtdvtflldrftlvgktndnklvldllstkek slvgallraatyyfsdlevacvgtnawvgwtpngspvltevgdnpvvfsrrgttrfalpy taphrvlatvyngdckykptgtaprenirgdlatlaariasethipttfnygmiytqaev dvylrmkraelycprpvlthydhngrdrykttlvkpak
>d2wzr1_ b.121.4.0 (1:) automated matches {Foot-and-mouth disease virus [TaxId: 12122]} ttsagegadpvttdasahggdtrttrrahtdvtflldrftlvgktndnklvldllstkek slvgallraatyyfsdlevacvgtnawvgwtpngspvltevgdnpvvfsrrgttrfalpy taphrvlatvyngdckykptipttfnygmiytqaevdvylrmkraelycprpvlthydhn grdrykttlvkpak
Timeline for d2wzr1_: