Lineage for d2wzr1_ (2wzr 1:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431909Species Foot-and-mouth disease virus [TaxId:12122] [255672] (1 PDB entry)
  8. 2431910Domain d2wzr1_: 2wzr 1: [244362]
    Other proteins in same PDB: d2wzr3_
    automated match to d1fmd1_

Details for d2wzr1_

PDB Entry: 2wzr (more details), 3 Å

PDB Description: the structure of foot and mouth disease virus serotype sat1
PDB Compounds: (1:) Polyprotein

SCOPe Domain Sequences for d2wzr1_:

Sequence, based on SEQRES records: (download)

>d2wzr1_ b.121.4.0 (1:) automated matches {Foot-and-mouth disease virus [TaxId: 12122]}
ttsagegadpvttdasahggdtrttrrahtdvtflldrftlvgktndnklvldllstkek
slvgallraatyyfsdlevacvgtnawvgwtpngspvltevgdnpvvfsrrgttrfalpy
taphrvlatvyngdckykptgtaprenirgdlatlaariasethipttfnygmiytqaev
dvylrmkraelycprpvlthydhngrdrykttlvkpak

Sequence, based on observed residues (ATOM records): (download)

>d2wzr1_ b.121.4.0 (1:) automated matches {Foot-and-mouth disease virus [TaxId: 12122]}
ttsagegadpvttdasahggdtrttrrahtdvtflldrftlvgktndnklvldllstkek
slvgallraatyyfsdlevacvgtnawvgwtpngspvltevgdnpvvfsrrgttrfalpy
taphrvlatvyngdckykptipttfnygmiytqaevdvylrmkraelycprpvlthydhn
grdrykttlvkpak

SCOPe Domain Coordinates for d2wzr1_:

Click to download the PDB-style file with coordinates for d2wzr1_.
(The format of our PDB-style files is described here.)

Timeline for d2wzr1_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wzr3_