![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.293: Phosphoprotein M1, C-terminal domain [118172] (1 superfamily) consists of 6 helices and one beta-hairpin |
![]() | Superfamily d.293.1: Phosphoprotein M1, C-terminal domain [118173] (2 families) ![]() automatically mapped to Pfam PF03012 |
![]() | Family d.293.1.0: automated matches [254279] (1 protein) not a true family |
![]() | Protein automated matches [254647] (1 species) not a true protein |
![]() | Species Mokola virus [TaxId:12538] [255671] (1 PDB entry) |
![]() | Domain d2wzla_: 2wzl A: [244361] automated match to d1vyia_ complexed with gol |
PDB Entry: 2wzl (more details), 2.1 Å
SCOPe Domain Sequences for d2wzla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wzla_ d.293.1.0 (A:) automated matches {Mokola virus [TaxId: 12538]} diegevahqvaesfskkykfpsrssgiflwnfeqlkmnlddivkaamnvpgveriaekgg klplrcilgfvaldsskrfrlladndkvarliqedinsymarleeae
Timeline for d2wzla_: