Lineage for d2wzha3 (2wzh A:437-588)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020210Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2020211Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2020243Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 2020244Protein automated matches [254554] (2 species)
    not a true protein
  7. 2020245Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries)
  8. 2020248Domain d2wzha3: 2wzh A:437-588 [244360]
    Other proteins in same PDB: d2wzha1, d2wzha2
    automated match to d2choa1
    complexed with ca, gol, ngo

Details for d2wzha3

PDB Entry: 2wzh (more details), 2.2 Å

PDB Description: btgh84 d242n in complex with meumb-derived oxazoline
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2wzha3:

Sequence, based on SEQRES records: (download)

>d2wzha3 a.246.1.0 (A:437-588) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldatt

Sequence, based on observed residues (ATOM records): (download)

>d2wzha3 a.246.1.0 (A:437-588) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkta
trvikplidrtfatvvkffnqkfnahldatt

SCOPe Domain Coordinates for d2wzha3:

Click to download the PDB-style file with coordinates for d2wzha3.
(The format of our PDB-style files is described here.)

Timeline for d2wzha3: