Lineage for d1g8kd_ (1g8k D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1782958Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1782959Protein Arsenite oxidase Rieske subunit [50029] (1 species)
  7. 1782960Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)
  8. 1782962Domain d1g8kd_: 1g8k D: [24436]
    Other proteins in same PDB: d1g8ka1, d1g8ka2, d1g8kc1, d1g8kc2, d1g8ke1, d1g8ke2, d1g8kg1, d1g8kg2
    complexed with 4mo, ca, edo, f3s, fes, hg, mgd, o

Details for d1g8kd_

PDB Entry: 1g8k (more details), 1.64 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
PDB Compounds: (D:) arsenite oxidase

SCOPe Domain Sequences for d1g8kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8kd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]}
rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
vdgliygrqanvi

SCOPe Domain Coordinates for d1g8kd_:

Click to download the PDB-style file with coordinates for d1g8kd_.
(The format of our PDB-style files is described here.)

Timeline for d1g8kd_: