| Class b: All beta proteins [48724] (119 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
| Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins) |
| Protein Arsenite oxidase Rieske subunit [50029] (1 species) |
| Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries) |
| Domain d1g8kd_: 1g8k D: [24436] Other proteins in same PDB: d1g8ka1, d1g8ka2, d1g8kc1, d1g8kc2, d1g8ke1, d1g8ke2, d1g8kg1, d1g8kg2 |
PDB Entry: 1g8k (more details), 1.64 Å
SCOP Domain Sequences for d1g8kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8kd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis}
rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
vdgliygrqanvi
Timeline for d1g8kd_: