SCOPe 2.08: Domain d2wyka1: 2wyk A:1-306

Lineage for d2wyka1 (2wyk A:1-306)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Sialic acid-binding protein SiaP [254345] (1 species)
   Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222

7. Species Haemophilus influenzae [TaxId:727] [254778] (7 PDB entries)

8. Domain d2wyka1: 2wyk A:1-306 [244355]
   Other proteins in same PDB: d2wyka2
   automated match to d2ceya_
   complexed with nge, scn
   has additional insertions and/or extensions that are not grouped together

Details for d2wyka1

PDB Entry: 2wyk, 1.5 Å

PDB Description: siap in complex with neu5gc

PDB Compounds: (A:) Sialic acid-binding periplasmic protein siaP

SCOPe Domain Sequences for d2wyka1:

Sequence; same for both SEQRES and ATOM records:

>d2wyka1 c.94.1.1 (A:1-306) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainp

Timeline for d2wyka1:

• d2wyka1 first appeared in SCOPe 2.04, called d2wyka_
  
• d2wyka1 appears in SCOPe 2.07