![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
![]() | Domain d2wy3c_: 2wy3 C: [244354] automated match to d1tmca_ complexed with act, nag, peu |
PDB Entry: 2wy3 (more details), 1.8 Å
SCOPe Domain Sequences for d2wy3c_:
Sequence, based on SEQRES records: (download)
>d2wy3c_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetwd tetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelflsq nletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksg
>d2wy3c_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetwd tetedltengqdlrrtlthilhslqeirvceihedsstrgsrhfyyngelflsqnletqe stvpqssraqtlamnvtnfwkamktkthyramqadclqklqrylksg
Timeline for d2wy3c_: