Lineage for d2wy3c_ (2wy3 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938681Domain d2wy3c_: 2wy3 C: [244354]
    automated match to d1tmca_
    complexed with act, nag, peu

Details for d2wy3c_

PDB Entry: 2wy3 (more details), 1.8 Å

PDB Description: structure of the hcmv ul16-micb complex elucidates select binding of a viral immunoevasin to diverse nkg2d ligands
PDB Compounds: (C:) MHC class I polypeptide-related sequence b

SCOPe Domain Sequences for d2wy3c_:

Sequence, based on SEQRES records: (download)

>d2wy3c_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetwd
tetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelflsq
nletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksg

Sequence, based on observed residues (ATOM records): (download)

>d2wy3c_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetwd
tetedltengqdlrrtlthilhslqeirvceihedsstrgsrhfyyngelflsqnletqe
stvpqssraqtlamnvtnfwkamktkthyramqadclqklqrylksg

SCOPe Domain Coordinates for d2wy3c_:

Click to download the PDB-style file with coordinates for d2wy3c_.
(The format of our PDB-style files is described here.)

Timeline for d2wy3c_: