Lineage for d2wx9a_ (2wx9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 protein domains)
  6. 1879927Protein automated matches [190140] (18 species)
    not a true protein
  7. 1880011Species Haemophilus influenzae [TaxId:727] [255670] (6 PDB entries)
  8. 1880013Domain d2wx9a_: 2wx9 A: [244351]
    automated match to d2ceya_
    complexed with nge

Details for d2wx9a_

PDB Entry: 2wx9 (more details), 1.37 Å

PDB Description: crystal structure of the sialic acid binding periplasmic protein siap
PDB Compounds: (A:) Sialic acid-binding periplasmic protein siaP

SCOPe Domain Sequences for d2wx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wx9a_ c.94.1.1 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnngtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainphh

SCOPe Domain Coordinates for d2wx9a_:

Click to download the PDB-style file with coordinates for d2wx9a_.
(The format of our PDB-style files is described here.)

Timeline for d2wx9a_: