Lineage for d1g8kb_ (1g8k B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109277Fold b.33: ISP domain [50021] (1 superfamily)
  4. 109278Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 109279Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
  6. 109280Protein Arsenite oxidase Rieske subunit [50029] (1 species)
  7. 109281Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)
  8. 109282Domain d1g8kb_: 1g8k B: [24435]
    Other proteins in same PDB: d1g8ka1, d1g8ka2, d1g8kc1, d1g8kc2, d1g8ke1, d1g8ke2, d1g8kg1, d1g8kg2

Details for d1g8kb_

PDB Entry: 1g8k (more details), 1.64 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis}
rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
vdgliygrqanvi

SCOP Domain Coordinates for d1g8kb_:

Click to download the PDB-style file with coordinates for d1g8kb_.
(The format of our PDB-style files is described here.)

Timeline for d1g8kb_: