Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Species Zymomonas mobilis [TaxId:542] [255668] (4 PDB entries) |
Domain d2wvhz3: 2wvh Z:363-566 [244348] Other proteins in same PDB: d2wvha2, d2wvhb2, d2wvhe2, d2wvhf2, d2wvhv2, d2wvhx2, d2wvhy2, d2wvhz2 automated match to d1zpda3 |
PDB Entry: 2wvh (more details), 2.3 Å
SCOPe Domain Sequences for d2wvhz3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvhz3 c.36.1.0 (Z:363-566) automated matches {Zymomonas mobilis [TaxId: 542]} aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn niknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigre dcteelvkwgkrvaaansrkpvnk
Timeline for d2wvhz3: