SCOPe 2.05: Domain d1rfsa_: 1rfs A:

Lineage for d1rfsa_ (1rfs A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein ISP subunit from chloroplast cytochrome bf complex [50027] (1 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [50028] (1 PDB entry)

8. Domain d1rfsa_: 1rfs A: [24434]
   complexed with fes

Details for d1rfsa_

PDB Entry: 1rfs, 1.83 Å

PDB Description: rieske soluble fragment from spinach

PDB Compounds: (A:) rieske protein

SCOPe Domain Sequences for d1rfsa_:

Sequence; same for both SEQRES and ATOM records:

>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]}
tiakdalgndviaaewlkthapgdrtltqglkgdptylvvesdktlatfginavcthlgc
vvpfnaaenkficpchgsqynnqgrvvrgpaplslalahcdvddgkvvfvpwtetdfrtg
eapwwsa

Timeline for d1rfsa_:

• d1rfsa_ first appeared (with stable ids) in SCOP 1.55, called d1rfs__
  
• d1rfsa_ appears in SCOPe 2.04
  
• d1rfsa_ appears in SCOPe 2.06
  
• d1rfsa_ appears in the current release, SCOPe 2.08