Lineage for d1rfs__ (1rfs -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.33: ISP domain [50021] (1 superfamily) Superfamily b.33.1: ISP domain [50022] (2 families) 
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins) 
Protein ISP subunit from chloroplast cytochrome bf complex [50027] (1 species) Species Spinach (Spinacia oleracea) [TaxId:3562] [50028] (1 PDB entry) 
Domain d1rfs__: 1rfs - [24434]
Details for d1rfs__
PDB Entry: 1rfs (more details), 1.83 Å
PDB Description: rieske soluble fragment from spinach
SCOP Domain Sequences for d1rfs__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfs__ b.33.1.1 (-) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea)}
tiakdalgndviaaewlkthapgdrtltqglkgdptylvvesdktlatfginavcthlgc
vvpfnaaenkficpchgsqynnqgrvvrgpaplslalahcdvddgkvvfvpwtetdfrtg
eapwwsa
SCOP Domain Coordinates for d1rfs__:
Click to download the PDB-style file with coordinates for d1rfs__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rfs__:
- d1rfs__ first appeared (with stable ids) in SCOP 1.55
- d1rfs__ appears in SCOP 1.59
- d1rfs__ appears in the current release, SCOPe 2.08, called d1rfsa_
View in 3D