Lineage for d1rfsa_ (1rfs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782344Protein ISP subunit from chloroplast cytochrome bf complex [50027] (1 species)
  7. 2782345Species Spinach (Spinacia oleracea) [TaxId:3562] [50028] (1 PDB entry)
  8. 2782346Domain d1rfsa_: 1rfs A: [24434]
    complexed with fes

Details for d1rfsa_

PDB Entry: 1rfs (more details), 1.83 Å

PDB Description: rieske soluble fragment from spinach
PDB Compounds: (A:) rieske protein

SCOPe Domain Sequences for d1rfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]}
tiakdalgndviaaewlkthapgdrtltqglkgdptylvvesdktlatfginavcthlgc
vvpfnaaenkficpchgsqynnqgrvvrgpaplslalahcdvddgkvvfvpwtetdfrtg
eapwwsa

SCOPe Domain Coordinates for d1rfsa_:

Click to download the PDB-style file with coordinates for d1rfsa_.
(The format of our PDB-style files is described here.)

Timeline for d1rfsa_: