SCOPe 2.08: Domain d3bcce1: 3bcc E:70-196

Lineage for d3bcce1 (3bcc E:70-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50026] (3 PDB entries)
   Uniprot P13272 79-274 ! Uniprot P13272 # precursor of chains I,E and V,R

8. Domain d3bcce1: 3bcc E:70-196 [24433]
   Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
   complexed with amy, fes, hem, sig

Details for d3bcce1

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

PDB Compounds: (E:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bcce1:

Sequence; same for both SEQRES and ATOM records:

>d3bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Chicken (Gallus gallus) [TaxId: 9031]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

Timeline for d3bcce1:

• d3bcce1 first appeared (with stable ids) in SCOP 1.55
  
• d3bcce1 appears in SCOPe 2.07