Lineage for d2wvha1 (2wvh A:1-187)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122891Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2122892Protein automated matches [227126] (20 species)
    not a true protein
  7. 2123231Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries)
  8. 2123252Domain d2wvha1: 2wvh A:1-187 [244325]
    Other proteins in same PDB: d2wvha2, d2wvhb2, d2wvhe2, d2wvhf2, d2wvhv2, d2wvhx2, d2wvhy2, d2wvhz2
    automated match to d1zpda2

Details for d2wvha1

PDB Entry: 2wvh (more details), 2.3 Å

PDB Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis
PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d2wvha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvha1 c.36.1.0 (A:1-187) automated matches {Zymomonas mobilis [TaxId: 542]}
msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
asalfnd

SCOPe Domain Coordinates for d2wvha1:

Click to download the PDB-style file with coordinates for d2wvha1.
(The format of our PDB-style files is described here.)

Timeline for d2wvha1: