![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (21 species) not a true protein |
![]() | Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries) |
![]() | Domain d2wvgf1: 2wvg F:2-187 [244322] Other proteins in same PDB: d2wvga2, d2wvgb2, d2wvge2, d2wvgf2 automated match to d1zpda2 complexed with f, mg, tpu |
PDB Entry: 2wvg (more details), 1.75 Å
SCOPe Domain Sequences for d2wvgf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvgf1 c.36.1.0 (F:2-187) automated matches {Zymomonas mobilis [TaxId: 542]} sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa salfnd
Timeline for d2wvgf1: