SCOP 1.69: Domain d2bcce1: 2bcc E:70-196

Lineage for d2bcce1 (2bcc E:70-196)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (2 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [50026] (6 PDB entries)
Domain d2bcce1: 2bcc E:70-196 [24432]
Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_

Details for d2bcce1

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bcce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Chicken (Gallus gallus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d2bcce1:

Click to download the PDB-style file with coordinates for d2bcce1.
(The format of our PDB-style files is described here.)

Timeline for d2bcce1: