| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (9 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [255669] (5 PDB entries) |
| Domain d2wvgb2: 2wvg B:188-362 [244317] Other proteins in same PDB: d2wvga1, d2wvga3, d2wvgb1, d2wvgb3, d2wvge1, d2wvge3, d2wvgf1, d2wvgf3 automated match to d1zpda1 complexed with f, mg, tpu |
PDB Entry: 2wvg (more details), 1.75 Å
SCOPe Domain Sequences for d2wvgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvgb2 c.31.1.0 (B:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps
Timeline for d2wvgb2: