SCOPe 2.05: Domain d2wvga3: 2wvg A:363-566

Lineage for d2wvga3 (2wvg A:363-566)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (15 species)
   not a true protein

7. Species Zymomonas mobilis [TaxId:542] [255668] (5 PDB entries)

8. Domain d2wvga3: 2wvg A:363-566 [244315]
   Other proteins in same PDB: d2wvga2, d2wvgb2, d2wvge2, d2wvgf2
   automated match to d1zpda3
   complexed with f, mg, tpu

Details for d2wvga3

PDB Entry: 2wvg, 1.75 Å

PDB Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis

PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d2wvga3:

Sequence; same for both SEQRES and ATOM records:

>d2wvga3 c.36.1.0 (A:363-566) automated matches {Zymomonas mobilis [TaxId: 542]}
aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn
niknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigre
dcteelvkwgkrvaaansrkpvnk

Timeline for d2wvga3:

• d2wvga3 first appeared in SCOPe 2.04
  
• d2wvga3 appears in SCOPe 2.06
  
• d2wvga3 appears in the current release, SCOPe 2.08