Lineage for d2wvga1 (2wvg A:2-187)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (15 species)
    not a true protein
  7. 1593493Species Zymomonas mobilis [TaxId:542] [255668] (4 PDB entries)
  8. 1593494Domain d2wvga1: 2wvg A:2-187 [244313]
    Other proteins in same PDB: d2wvga2, d2wvgb2, d2wvge2, d2wvgf2
    automated match to d1zpda2
    complexed with f, mg, tpu

Details for d2wvga1

PDB Entry: 2wvg (more details), 1.75 Å

PDB Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis
PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d2wvga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvga1 c.36.1.0 (A:2-187) automated matches {Zymomonas mobilis [TaxId: 542]}
sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
salfnd

SCOPe Domain Coordinates for d2wvga1:

Click to download the PDB-style file with coordinates for d2wvga1.
(The format of our PDB-style files is described here.)

Timeline for d2wvga1: