| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.0: automated matches [230594] (1 protein) not a true family |
| Protein automated matches [230595] (4 species) not a true protein |
| Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries) |
| Domain d2wvfb1: 2wvf B:9-60 [244311] Other proteins in same PDB: d2wvfa2, d2wvfb2 automated match to d2wvcb1 complexed with fmt, gol, ni, so4 |
PDB Entry: 2wvf (more details), 1.6 Å
SCOPe Domain Sequences for d2wvfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvfb1 a.43.1.0 (B:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}
siirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn
Timeline for d2wvfb1: