SCOPe 2.07: Domain d2wvfa2: 2wvf A:61-142

Lineage for d2wvfa2 (2wvf A:61-142)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)

8. Domain d2wvfa2: 2wvf A:61-142 [244310]
   Other proteins in same PDB: d2wvfa1, d2wvfb1
   automated match to d2wvcb2
   complexed with fmt, gol, ni, so4

Details for d2wvfa2

PDB Entry: 2wvf, 1.6 Å

PDB Description: structural and mechanistic insights into helicobacter pylori nikr function

PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2wvfa2:

Sequence; same for both SEQRES and ATOM records:

>d2wvfa2 d.58.18.0 (A:61-142) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydggqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltkas

Timeline for d2wvfa2:

• d2wvfa2 first appeared in SCOPe 2.04
  
• d2wvfa2 appears in SCOPe 2.06
  
• d2wvfa2 appears in the current release, SCOPe 2.08