Lineage for d1bcce1 (1bcc E:70-196)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.33: ISP domain [50021] (1 superfamily) Superfamily b.33.1: ISP domain [50022] (2 families) 
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins) Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [50026] (3 PDB entries) 
Domain d1bcce1: 1bcc E:70-196 [24431]
Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc1, d1bccd2, d1bccd3, d1bcce2, d1bccf1, d1bccg1, d1bcch1, d1bccj1
Details for d1bcce1
PDB Entry: 1bcc (more details), 3.16 Å
PDB Description: cytochrome bc1 complex from chicken
SCOP Domain Sequences for d1bcce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Chicken (Gallus gallus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg
SCOP Domain Coordinates for d1bcce1:
Click to download the PDB-style file with coordinates for d1bcce1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bcce1:
View in 3D
