| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries) |
| Domain d2wvay3: 2wva Y:363-566 [244305] Other proteins in same PDB: d2wvaa2, d2wvab2, d2wvae2, d2wvaf2, d2wvav2, d2wvax2, d2wvay2, d2wvaz2 automated match to d1zpda3 complexed with mg, pyr, tpu |
PDB Entry: 2wva (more details), 2.2 Å
SCOPe Domain Sequences for d2wvay3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvay3 c.36.1.0 (Y:363-566) automated matches {Zymomonas mobilis [TaxId: 542]}
aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn
niknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigre
dcteelvkwgkrvaaansrkpvnk
Timeline for d2wvay3: